Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6pujf_: 6puj F: [381014] Other proteins in same PDB: d6puja1, d6puja2, d6puja3, d6pujb1, d6pujb2, d6pujc1, d6pujc2, d6pujc3, d6pujd1, d6pujd2, d6puje1, d6puje2, d6pujg1, d6pujg2 automated match to d1duzb_ complexed with cl, gol, na, q7s |
PDB Entry: 6puj (more details), 1.92 Å
SCOPe Domain Sequences for d6pujf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pujf_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d6pujf_: