SCOPe 2.08: Domain d6pujb1: 6puj B:1-110

Lineage for d6pujb1 (6puj B:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6pujb1: 6puj B:1-110 [381003]
   Other proteins in same PDB: d6puja1, d6puja3, d6pujb2, d6pujc1, d6pujc3, d6pujd2, d6pujf_, d6pujh_
   automated match to d2f54d1
   complexed with cl, gol, na, q7s

Details for d6pujb1

PDB Entry: 6puj, 1.92 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-3`oh- propyl-5-op-u

PDB Compounds: (B:) Human TCR alpha chain

SCOPe Domain Sequences for d6pujb1:

Sequence; same for both SEQRES and ATOM records:

>d6pujb1 b.1.1.0 (B:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d6pujb1:

• d6pujb1 first appeared in SCOPe 2.07