Lineage for d6pujd2 (6puj D:111-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750466Domain d6pujd2: 6puj D:111-198 [380984]
    Other proteins in same PDB: d6puja1, d6puja2, d6puja3, d6pujb1, d6pujc1, d6pujc2, d6pujc3, d6pujd1, d6puje1, d6puje2, d6pujf_, d6pujg1, d6pujg2, d6pujh_
    automated match to d2f54d2
    complexed with cl, gol, na, q7s

Details for d6pujd2

PDB Entry: 6puj (more details), 1.92 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-3`oh- propyl-5-op-u
PDB Compounds: (D:) Human TCR alpha chain

SCOPe Domain Sequences for d6pujd2:

Sequence, based on SEQRES records: (download)

>d6pujd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d6pujd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d6pujd2:

Click to download the PDB-style file with coordinates for d6pujd2.
(The format of our PDB-style files is described here.)

Timeline for d6pujd2: