Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6pujd1: 6puj D:1-110 [380983] Other proteins in same PDB: d6puja1, d6puja3, d6pujb2, d6pujc1, d6pujc3, d6pujd2, d6pujf_, d6pujh_ automated match to d2f54d1 complexed with cl, gol, na, q7s |
PDB Entry: 6puj (more details), 1.92 Å
SCOPe Domain Sequences for d6pujd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pujd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd
Timeline for d6pujd1: