Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6pujc1: 6puj C:1-178 [380938] Other proteins in same PDB: d6puja2, d6puja3, d6pujb1, d6pujb2, d6pujc2, d6pujc3, d6pujd1, d6pujd2, d6puje1, d6puje2, d6pujf_, d6pujg1, d6pujg2, d6pujh_ automated match to d4l4va1 complexed with cl, gol, na, q7s |
PDB Entry: 6puj (more details), 1.92 Å
SCOPe Domain Sequences for d6pujc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pujc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6pujc1: