Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6pula1: 6pul A:1-178 [380921] Other proteins in same PDB: d6pula2, d6pula3, d6pulb1, d6pulb2, d6pulc2, d6pulc3, d6puld1, d6puld2, d6pule1, d6pule2, d6pulf1, d6pulf2, d6pulg1, d6pulg2, d6pulh1, d6pulh2 automated match to d4l4va1 complexed with act, gol, na, q81 |
PDB Entry: 6pul (more details), 1.84 Å
SCOPe Domain Sequences for d6pula1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pula1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6pula1: