SCOPe 2.08: Domain d6pued2: 6pue D:111-198

Lineage for d6pued2 (6pue D:111-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6pued2: 6pue D:111-198 [380903]
   Other proteins in same PDB: d6puea1, d6puea2, d6puea3, d6pueb_, d6puec1, d6puec2, d6puec3, d6pued1, d6puee1, d6puee2, d6puef1, d6puef2, d6pueg1, d6pueh1, d6pueh2
   automated match to d2f54d2
   complexed with gol, na, q7j

Details for d6pued2

PDB Entry: 6pue, 1.9 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-4'd-5-op-ru

PDB Compounds: (D:) Human TCR alpha chain

SCOPe Domain Sequences for d6pued2:

Sequence, based on SEQRES records:

>d6pued2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d6pued2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssvclftdfdsqtnvsqsdvyitdkcvldmrsmdfksnsavawsn
kdfacanafnnsiipedtffp

Timeline for d6pued2:

• d6pued2 first appeared in SCOPe 2.07