Lineage for d6ql8a_ (6ql8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927669Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)
  8. 2927697Domain d6ql8a_: 6ql8 A: [380892]
    automated match to d5ja7a_
    complexed with j5n, no3

Details for d6ql8a_

PDB Entry: 6ql8 (more details), 1.8 Å

PDB Description: cathepsin-k in complex with miv-711
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d6ql8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ql8a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvs
endgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegne
kalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhw
iiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d6ql8a_:

Click to download the PDB-style file with coordinates for d6ql8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ql8a_: