Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6pugg2: 6pug G:111-200 [380886] Other proteins in same PDB: d6puga1, d6puga2, d6puga3, d6pugb1, d6pugb2, d6pugc1, d6pugc2, d6pugc3, d6pugd1, d6puge1, d6puge2, d6pugf1, d6pugf2, d6pugg1, d6pugh1, d6pugh2 automated match to d2f54d2 complexed with cl, gol, na, ozd |
PDB Entry: 6pug (more details), 1.8 Å
SCOPe Domain Sequences for d6pugg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pugg2 b.1.1.2 (G:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d6pugg2: