Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6pukd1: 6puk D:1-110 [380880] Other proteins in same PDB: d6puka1, d6puka3, d6pukb2, d6pukc1, d6pukc3, d6pukd2, d6pukf1, d6pukf2, d6pukh1, d6pukh2 automated match to d2f54d1 complexed with act, gol, na, oyv |
PDB Entry: 6puk (more details), 2.08 Å
SCOPe Domain Sequences for d6pukd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pukd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd
Timeline for d6pukd1: