Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6pugc1: 6pug C:1-178 [380869] Other proteins in same PDB: d6puga2, d6puga3, d6pugb1, d6pugb2, d6pugc2, d6pugc3, d6pugd1, d6pugd2, d6puge1, d6puge2, d6pugf1, d6pugf2, d6pugg1, d6pugg2, d6pugh1, d6pugh2 automated match to d4l4va1 complexed with cl, gol, na, ozd |
PDB Entry: 6pug (more details), 1.8 Å
SCOPe Domain Sequences for d6pugc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pugc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6pugc1: