Lineage for d6pugc1 (6pug C:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938714Domain d6pugc1: 6pug C:1-178 [380869]
    Other proteins in same PDB: d6puga2, d6puga3, d6pugb1, d6pugb2, d6pugc2, d6pugc3, d6pugd1, d6pugd2, d6puge1, d6puge2, d6pugf1, d6pugf2, d6pugg1, d6pugg2, d6pugh1, d6pugh2
    automated match to d4l4va1
    complexed with cl, gol, na, ozd

Details for d6pugc1

PDB Entry: 6pug (more details), 1.8 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-2`oh-ethyl- 5-op-u
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6pugc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pugc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d6pugc1:

Click to download the PDB-style file with coordinates for d6pugc1.
(The format of our PDB-style files is described here.)

Timeline for d6pugc1: