SCOPe 2.08: Domain d6puge1: 6pug E:3-116

Lineage for d6puge1 (6pug E:3-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6puge1: 6pug E:3-116 [380849]
   Other proteins in same PDB: d6puga1, d6puga3, d6pugb1, d6pugb2, d6pugc1, d6pugc3, d6pugd2, d6pugf1, d6pugf2, d6pugg2
   automated match to d2axha1
   complexed with cl, gol, na, ozd

Details for d6puge1

PDB Entry: 6pug, 1.8 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-2`oh-ethyl- 5-op-u

PDB Compounds: (E:) Human TCR beta chain

SCOPe Domain Sequences for d6puge1:

Sequence; same for both SEQRES and ATOM records:

>d6puge1 b.1.1.0 (E:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d6puge1:

• d6puge1 first appeared in SCOPe 2.07