SCOPe 2.08: Domain d6pule1: 6pul E:2-116

Lineage for d6pule1 (6pul E:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6pule1: 6pul E:2-116 [380814]
   Other proteins in same PDB: d6pula1, d6pula3, d6pulb2, d6pulc1, d6pulc3, d6puld2, d6pulf1, d6pulf2, d6pulh1, d6pulh2
   automated match to d2axha1
   complexed with act, gol, na, q81

Details for d6pule1

PDB Entry: 6pul, 1.84 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1 3'd-5-op-ru

PDB Compounds: (E:) Human TCR beta chain

SCOPe Domain Sequences for d6pule1:

Sequence; same for both SEQRES and ATOM records:

>d6pule1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d6pule1:

• d6pule1 first appeared in SCOPe 2.07