SCOPe 2.08: Domain d7stdc1: 7std C:10-172

Lineage for d7stdc1 (7std C:10-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
   automatically mapped to Pfam PF02982

6. Protein Scytalone dehydratase [54429] (1 species)

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)

8. Domain d7stdc1: 7std C:10-172 [38081]
   Other proteins in same PDB: d7stda2, d7stdb2, d7stdc2
   complexed with ca, crp

Details for d7stdc1

PDB Entry: 7std, 1.8 Å

PDB Description: scytalone dehydratase plus inhibitor 4

PDB Compounds: (C:) scytalone dehydratase

SCOPe Domain Sequences for d7stdc1:

Sequence; same for both SEQRES and ATOM records:

>d7stdc1 d.17.4.1 (C:10-172) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
eitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvgm
vsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghahs
anlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk

Timeline for d7stdc1:

• d7stdc1 first appeared (with stable ids) in SCOP 1.55, called d7stdc_
  
• d7stdc1 appears in SCOPe 2.07