SCOPe 2.06: Domain d7stdb_: 7std B:

Lineage for d7stdb_ (7std B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
   automatically mapped to Pfam PF02982

6. Protein Scytalone dehydratase [54429] (1 species)

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)

8. Domain d7stdb_: 7std B: [38080]
   complexed with ca, crp

Details for d7stdb_

PDB Entry: 7std, 1.8 Å

PDB Description: scytalone dehydratase plus inhibitor 4

PDB Compounds: (B:) protein (scytalone dehydratase)

SCOPe Domain Sequences for d7stdb_:

Sequence; same for both SEQRES and ATOM records:

>d7stdb_ d.17.4.1 (B:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
geitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg
mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah
sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk

Timeline for d7stdb_:

• d7stdb_ first appeared (with stable ids) in SCOP 1.55
  
• d7stdb_ appears in SCOPe 2.05
  
• d7stdb_ is called d7stdb1 in SCOPe 2.07
  
• d7stdb_ appears in the current release, SCOPe 2.08, called d7stdb1