SCOPe 2.08: Domain d6pucg2: 6puc G:111-200

Lineage for d6pucg2 (6puc G:111-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6pucg2: 6puc G:111-200 [380799]
   Other proteins in same PDB: d6puca1, d6puca2, d6puca3, d6pucb1, d6pucb2, d6pucc1, d6pucc2, d6pucc3, d6pucd1, d6puce1, d6puce2, d6pucf1, d6pucf2, d6pucg1, d6puch1, d6puch2
   automated match to d2f54d2
   complexed with cl, gol, na, q87

Details for d6pucg2

PDB Entry: 6puc, 1.85 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-5-op-ru

PDB Compounds: (G:) Human TCR alpha chain

SCOPe Domain Sequences for d6pucg2:

Sequence; same for both SEQRES and ATOM records:

>d6pucg2 b.1.1.2 (G:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Timeline for d6pucg2:

• d6pucg2 first appeared in SCOPe 2.07