Lineage for d6puhb2 (6puh B:111-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750386Domain d6puhb2: 6puh B:111-200 [380790]
    Other proteins in same PDB: d6puha1, d6puha2, d6puha3, d6puhb1, d6puhc1, d6puhc2, d6puhc3, d6puhd1, d6puhe1, d6puhe2, d6puhf1, d6puhf2, d6puhg1, d6puhg2, d6puhh1, d6puhh2
    automated match to d2f54d2
    complexed with na, oyg

Details for d6puhb2

PDB Entry: 6puh (more details), 1.88 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-ribityl- less
PDB Compounds: (B:) Human TCR alpha chain

SCOPe Domain Sequences for d6puhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6puhb2 b.1.1.2 (B:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d6puhb2:

Click to download the PDB-style file with coordinates for d6puhb2.
(The format of our PDB-style files is described here.)

Timeline for d6puhb2: