Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6puhb2: 6puh B:111-200 [380790] Other proteins in same PDB: d6puha1, d6puha2, d6puha3, d6puhb1, d6puhc1, d6puhc2, d6puhc3, d6puhd1, d6puhe1, d6puhe2, d6puhf1, d6puhf2, d6puhg1, d6puhg2, d6puhh1, d6puhh2 automated match to d2f54d2 complexed with na, oyg |
PDB Entry: 6puh (more details), 1.88 Å
SCOPe Domain Sequences for d6puhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6puhb2 b.1.1.2 (B:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d6puhb2: