Lineage for d7stda1 (7std A:10-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936288Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
    automatically mapped to Pfam PF02982
  6. 2936289Protein Scytalone dehydratase [54429] (1 species)
  7. 2936290Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)
  8. 2936301Domain d7stda1: 7std A:10-172 [38079]
    Other proteins in same PDB: d7stda2, d7stdb2, d7stdc2
    complexed with ca, crp

Details for d7stda1

PDB Entry: 7std (more details), 1.8 Å

PDB Description: scytalone dehydratase plus inhibitor 4
PDB Compounds: (A:) scytalone dehydratase

SCOPe Domain Sequences for d7stda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7stda1 d.17.4.1 (A:10-172) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
eitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvgm
vsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghahs
anlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk

SCOPe Domain Coordinates for d7stda1:

Click to download the PDB-style file with coordinates for d7stda1.
(The format of our PDB-style files is described here.)

Timeline for d7stda1: