Lineage for d6puic2 (6pui C:179-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755791Domain d6puic2: 6pui C:179-270 [380784]
    Other proteins in same PDB: d6puia1, d6puia3, d6puib2, d6puic1, d6puic3, d6puid2, d6puif1, d6puif2, d6puih1, d6puih2
    automated match to d4l4va2
    complexed with gol, na, q7p

Details for d6puic2

PDB Entry: 6pui (more details), 1.96 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-4'oh-butyl- 5-op-u
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6puic2:

Sequence, based on SEQRES records: (download)

>d6puic2 b.1.1.0 (C:179-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqvp

Sequence, based on observed residues (ATOM records): (download)

>d6puic2 b.1.1.0 (C:179-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldsnlyschvehsgvhmvlqvp

SCOPe Domain Coordinates for d6puic2:

Click to download the PDB-style file with coordinates for d6puic2.
(The format of our PDB-style files is described here.)

Timeline for d6puic2: