Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries) Uniprot P68871 |
Domain d6l5xd_: 6l5x D: [380670] Other proteins in same PDB: d6l5xa_, d6l5xc_ automated match to d1irdb_ complexed with cmo, hem |
PDB Entry: 6l5x (more details), 1.65 Å
SCOPe Domain Sequences for d6l5xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l5xd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d6l5xd_: