Lineage for d1ekmb3 (1ekm B:116-236)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30987Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 30988Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 30989Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 31039Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (2 PDB entries)
  8. 31043Domain d1ekmb3: 1ekm B:116-236 [38056]
    Other proteins in same PDB: d1ekma1, d1ekmb1, d1ekmc1

Details for d1ekmb3

PDB Entry: 1ekm (more details), 2.5 Å

PDB Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli

SCOP Domain Sequences for d1ekmb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekmb3 d.17.2.1 (B:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha)}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOP Domain Coordinates for d1ekmb3:

Click to download the PDB-style file with coordinates for d1ekmb3.
(The format of our PDB-style files is described here.)

Timeline for d1ekmb3: