SCOPe 2.07: Domain d6u12a_: 6u12 A:

Lineage for d6u12a_ (6u12 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein automated matches [226952] (2 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [354876] (3 PDB entries)

8. Domain d6u12a_: 6u12 A: [380541]
   Other proteins in same PDB: d6u12b_
   automated match to d1d0ba_

Details for d6u12a_

PDB Entry: 6u12, 1.56 Å

PDB Description: vhh r303 c33a/c102a in complex withthe lrr domain of inlb

PDB Compounds: (A:) InlB

SCOPe Domain Sequences for d6u12a_:

Sequence; same for both SEQRES and ATOM records:

>d6u12a_ c.10.2.1 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikplvnlknlgwlfldenkikdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
sknhisdlralaglknldvlelfsqea

Timeline for d6u12a_:

• d6u12a_ is new in SCOPe 2.07-stable
  
• d6u12a_ appears in the current release, SCOPe 2.08