SCOP 1.57: Domain d1avl_3: 1avl 97-211

Lineage for d1avl_3 (1avl 97-211)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (3 PDB entries)

8. Domain d1avl_3: 1avl 97-211 [38052]
   Other proteins in same PDB: d1avl_1

Details for d1avl_3

PDB Entry: 1avl, 2.8 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone

SCOP Domain Sequences for d1avl_3:

Sequence; same for both SEQRES and ATOM records:

>d1avl_3 d.17.2.1 (97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1avl_3:

• d1avl_3 first appeared (with stable ids) in SCOP 1.55
  
• d1avl_3 appears in SCOP 1.59
  
• d1avl_3 appears in the current release, SCOPe 2.08, called d1avla3