Lineage for d1av4a3 (1av4 A:97-211)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718737Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 718738Species Arthrobacter globiformis [TaxId:1665] [54421] (34 PDB entries)
  8. 718832Domain d1av4a3: 1av4 A:97-211 [38050]
    Other proteins in same PDB: d1av4a1
    complexed with cu

Details for d1av4a3

PDB Entry: 1av4 (more details), 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone
PDB Compounds: (A:) amine oxidase

SCOP Domain Sequences for d1av4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av4a3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1av4a3:

Click to download the PDB-style file with coordinates for d1av4a3.
(The format of our PDB-style files is described here.)

Timeline for d1av4a3: