Lineage for d5qu6u_ (5qu6 U:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783497Domain d5qu6u_: 5qu6 U: [380493]
    Other proteins in same PDB: d5qu6e2, d5qu6k2, d5qu6l2, d5qu6o2
    automated match to d5hcka_

Details for d5qu6u_

PDB Entry: 5qu6 (more details), 1.82 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.8a, triclinic
PDB Compounds: (U:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu6u_:

Sequence, based on SEQRES records: (download)

>d5qu6u_ b.34.2.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk

Sequence, based on observed residues (ATOM records): (download)

>d5qu6u_ b.34.2.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyvaqqeqeldikknerlwllkswwrvrnsmnktgfvpsnyverk

SCOPe Domain Coordinates for d5qu6u_:

Click to download the PDB-style file with coordinates for d5qu6u_.
(The format of our PDB-style files is described here.)

Timeline for d5qu6u_: