Lineage for d1ksia3 (1ksi A:99-206)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30987Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 30988Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 30989Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 31034Species Pea seedling (Pisum sativum) [TaxId:3888] [54420] (1 PDB entry)
  8. 31036Domain d1ksia3: 1ksi A:99-206 [38044]
    Other proteins in same PDB: d1ksia1, d1ksib1

Details for d1ksia3

PDB Entry: 1ksi (more details), 2.2 Å

PDB Description: crystal structure of a eukaryotic (pea seedling) copper-containing amine oxidase at 2.2a resolution

SCOP Domain Sequences for d1ksia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksia3 d.17.2.1 (A:99-206) Copper amine oxidase, domains 1 and 2 {Pea seedling (Pisum sativum)}
gfpilsvdeqslaiklplkyppfidsvkkrglnlseivcssftmgwfgeeknvrtvrldc
fmkestvniyvrpitgitivadldlmkiveyhdrdieavptaenteyq

SCOP Domain Coordinates for d1ksia3:

Click to download the PDB-style file with coordinates for d1ksia3.
(The format of our PDB-style files is described here.)

Timeline for d1ksia3: