Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (10 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [193198] (3 PDB entries) |
Domain d6kipa1: 6kip A:1213-1507 [380372] Other proteins in same PDB: d6kipa2 automated match to d3qcna_ |
PDB Entry: 6kip (more details), 1.91 Å
SCOPe Domain Sequences for d6kipa1:
Sequence, based on SEQRES records: (download)
>d6kipa1 c.45.1.0 (A:1213-1507) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ntevparnlyayiqkltqietgenvtgmelefkrlasskahtsrfisanlpcnkfknrlv nimpyestrvclqpirgvegsdyinasfldgyrqqkayiatqgplaettedfwrmlwehn stivvmltklremgrekchqywpaersaryqyfvvdpmaeynmpqyilrefkvtdardgq srtvrqfqftdwpeqgvpksgegfidfigqvhktkeqfgqdgpisvhcsagvgrtgvfit lsivlermryegvvdifqtvkmlrtqrpamvqtedqyqfcyraaleylgsfdhya
>d6kipa1 c.45.1.0 (A:1213-1507) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ntevparnlyayiqkltqietgenvtgmelefkrlasstsrfisanlpcnkfknrlvnim pyestrvclqpirgvegsdyinasfldgyrqqkayiatqgplaettedfwrmlwehnsti vvmltklremgrekchqywpaersaryqyfvvdpmaeynmpqyilrefkvtdardgqsrt vrqfqftdwpeqgvpksgegfidfigqvhktkeqfgqdgpisvhcsagvgrtgvfitlsi vlermryegvvdifqtvkmlrtqrpamvqtedqyqfcyraaleylgsfdhya
Timeline for d6kipa1: