Lineage for d6khih_ (6khi H:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573426Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2573427Protein automated matches [191173] (15 species)
    not a true protein
  7. 3065358Species Thermosynechococcus elongatus [TaxId:197221] [365420] (4 PDB entries)
  8. 3080296Domain d6khih_: 6khi H: [380358]
    Other proteins in same PDB: d6khi1_
    automated match to d3iam4_
    complexed with bcr, dgd, fes, lhg, lmg, sf4, sqd

Details for d6khih_

PDB Entry: 6khi (more details), 3 Å

PDB Description: supercomplex for cylic electron transport in cyanobacteria
PDB Compounds: (H:) NAD(P)H-quinone oxidoreductase subunit H

SCOPe Domain Sequences for d6khih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6khih_ e.18.1.0 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pkietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtni
mfipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgpf
ladvgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfcd
yflpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhye
cyddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlegak
sewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdfn
nlqvlpqllkgmkvadivailgsidvimgsvdr

SCOPe Domain Coordinates for d6khih_:

Click to download the PDB-style file with coordinates for d6khih_.
(The format of our PDB-style files is described here.)

Timeline for d6khih_:

  • d6khih_ is new in SCOPe 2.07-stable