Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) |
Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (9 PDB entries) |
Domain d1d6ub3: 1d6u B:186-300 [38034] Other proteins in same PDB: d1d6ua1, d1d6ua4, d1d6ub1, d1d6ub4 |
PDB Entry: 1d6u (more details), 2.4 Å
SCOP Domain Sequences for d1d6ub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ub3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1d6ub3:
View in 3D Domains from other chains: (mouse over for more information) d1d6ua1, d1d6ua2, d1d6ua3, d1d6ua4 |