Lineage for d6ebda_ (6ebd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007925Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 3007926Protein automated matches [190512] (7 species)
    not a true protein
  7. 3007936Species Chromobacterium violaceum [TaxId:536] [379744] (4 PDB entries)
  8. 3007949Domain d6ebda_: 6ebd A: [380313]
    Other proteins in same PDB: d6ebdc2
    automated match to d3i07a_
    complexed with cl, j3s; mutant

Details for d6ebda_

PDB Entry: 6ebd (more details), 2.61 Å

PDB Description: ohrb (organic hydroperoxide resistance protein) mutant (c60a) from chromobacterium violaceum, interacting with dihydrolipoamide
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6ebda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebda_ d.227.1.0 (A:) automated matches {Chromobacterium violaceum [TaxId: 536]}
sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaaaf
lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
ivcpysdatrgnidvrlrla

SCOPe Domain Coordinates for d6ebda_:

Click to download the PDB-style file with coordinates for d6ebda_.
(The format of our PDB-style files is described here.)

Timeline for d6ebda_: