Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (7 species) not a true protein |
Species Chromobacterium violaceum [TaxId:536] [379744] (4 PDB entries) |
Domain d6ebda_: 6ebd A: [380313] Other proteins in same PDB: d6ebdc2 automated match to d3i07a_ complexed with cl, j3s; mutant |
PDB Entry: 6ebd (more details), 2.61 Å
SCOPe Domain Sequences for d6ebda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ebda_ d.227.1.0 (A:) automated matches {Chromobacterium violaceum [TaxId: 536]} sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaaaf lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah ivcpysdatrgnidvrlrla
Timeline for d6ebda_:
View in 3D Domains from other chains: (mouse over for more information) d6ebdb_, d6ebdc1, d6ebdc2, d6ebdd_ |