SCOPe 2.08: Domain d6rwnk2: 6rwn K:57-217

Lineage for d6rwnk2 (6rwn K:57-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries)

8. Domain d6rwnk2: 6rwn K:57-217 [380295]
   Other proteins in same PDB: d6rwnc1, d6rwnd1, d6rwnd2, d6rwne1, d6rwne2, d6rwnf1, d6rwnk1, d6rwnl1, d6rwnl2, d6rwnm1, d6rwnm2, d6rwnn1
   automated match to d1k6ya2
   protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnk2

PDB Entry: 6rwn, 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir

PDB Compounds: (K:) pol protein

SCOPe Domain Sequences for d6rwnk2:

Sequence, based on SEQRES records:

>d6rwnk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqi

Sequence, based on observed residues (ATOM records):

>d6rwnk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfggvvesmnhqlktiitqirdqaekietavqmavlihn
fkrkggiggysageriidiiasdlqttklqnqi

Timeline for d6rwnk2:

• d6rwnk2 first appeared in SCOPe 2.07