Lineage for d1qafb2 (1qaf B:91-185)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131584Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 131625Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 131626Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 131627Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 131635Species Escherichia coli [TaxId:562] [54419] (10 PDB entries)
  8. 131658Domain d1qafb2: 1qaf B:91-185 [38029]
    Other proteins in same PDB: d1qafa1, d1qafa4, d1qafb1, d1qafb4

Details for d1qafb2

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants

SCOP Domain Sequences for d1qafb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1qafb2:

Click to download the PDB-style file with coordinates for d1qafb2.
(The format of our PDB-style files is described here.)

Timeline for d1qafb2: