SCOP 1.55: Domain d1spua3: 1spu A:186-300

Lineage for d1spua3 (1spu A:186-300)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Escherichia coli [TaxId:562] [54419] (9 PDB entries)

8. Domain d1spua3: 1spu A:186-300 [38024]
   Other proteins in same PDB: d1spua1, d1spua4, d1spub1, d1spub4

Details for d1spua3

PDB Entry: 1spu, 2 Å

PDB Description: structure of oxidoreductase

SCOP Domain Sequences for d1spua3:

Sequence; same for both SEQRES and ATOM records:

>d1spua3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

Timeline for d1spua3:

• d1spua3 appears in SCOP 1.57
  
• d1spua3 appears in the current release, SCOPe 2.08