SCOPe 2.08: Domain d6rwmk2: 6rwm K:57-217

Lineage for d6rwmk2 (6rwm K:57-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries)

8. Domain d6rwmk2: 6rwm K:57-217 [380229]
   Other proteins in same PDB: d6rwmc1, d6rwmd1, d6rwmd2, d6rwme1, d6rwme2, d6rwmf1, d6rwmk1, d6rwml1, d6rwml2, d6rwmm1, d6rwmm2, d6rwmn1
   automated match to d1k6ya2
   protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwmk2

PDB Entry: 6rwm, 2.81 Å

PDB Description: sivrcm intasome in complex with bictegravir

PDB Compounds: (K:) pol protein

SCOPe Domain Sequences for d6rwmk2:

Sequence, based on SEQRES records:

>d6rwmk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqi

Sequence, based on observed residues (ATOM records):

>d6rwmk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfggvvesmnhqlktiitqirdqaekietavqmavlihn
fkrkggiggysageriidiiasdlqttklqnqi

Timeline for d6rwmk2:

• d6rwmk2 first appeared in SCOPe 2.07