Lineage for d1dyub3 (1dyu B:186-300)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131584Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 131625Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 131626Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 131627Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 131635Species Escherichia coli [TaxId:562] [54419] (10 PDB entries)
  8. 131651Domain d1dyub3: 1dyu B:186-300 [38022]
    Other proteins in same PDB: d1dyua1, d1dyua4, d1dyub1, d1dyub4

Details for d1dyub3

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.

SCOP Domain Sequences for d1dyub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyub3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOP Domain Coordinates for d1dyub3:

Click to download the PDB-style file with coordinates for d1dyub3.
(The format of our PDB-style files is described here.)

Timeline for d1dyub3: