SCOPe 2.08: Domain d6rwom1: 6rwo M:1-46

Lineage for d6rwom1 (6rwo M:1-46)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families)

5. Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins)
   Zn-binding site is near the C-terminus
   Pfam PF02022

6. Protein Simian immunodeficiency virus [418890] (1 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:11723] [419293] (3 PDB entries)

8. Domain d6rwom1: 6rwo M:1-46 [380200]
   Other proteins in same PDB: d6rwoc2, d6rwod1, d6rwod2, d6rwoe2, d6rwof1, d6rwok2, d6rwol1, d6rwol2, d6rwom2, d6rwon1
   automated match to d1wjba_
   protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwom1

PDB Entry: 6rwo, 3.05 Å

PDB Description: sivrcm intasome (q148h/g140s) in complex with bictegravir

PDB Compounds: (M:) pol protein

SCOPe Domain Sequences for d6rwom1:

Sequence; same for both SEQRES and ATOM records:

>d6rwom1 a.4.10.1 (M:1-46) Simian immunodeficiency virus {Simian immunodeficiency virus [TaxId: 11723]}
fldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvk

Timeline for d6rwom1:

• d6rwom1 first appeared in SCOPe 2.07