Lineage for d1qakb3 (1qak B:186-300)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855529Species Escherichia coli [TaxId:562] [54419] (11 PDB entries)
  8. 855541Domain d1qakb3: 1qak B:186-300 [38014]
    Other proteins in same PDB: d1qaka1, d1qaka4, d1qakb1, d1qakb4
    complexed with ca, cu; mutant

Details for d1qakb3

PDB Entry: 1qak (more details), 2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (B:) copper amine oxidase

SCOP Domain Sequences for d1qakb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qakb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOP Domain Coordinates for d1qakb3:

Click to download the PDB-style file with coordinates for d1qakb3.
(The format of our PDB-style files is described here.)

Timeline for d1qakb3: