SCOPe 2.07: Domain d6lspb_: 6lsp B:

Lineage for d6lspb_ (6lsp B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)

8. Domain d6lspb_: 6lsp B: [379816]
   automated match to d4qaja_

Details for d6lspb_

PDB Entry: 6lsp, 1.5 Å

PDB Description: crystal structure of a dimeric piptidyl t-rna hydrolase from acinetobacter baumannii at 1.50 a resolution reveals an inhibited form.

PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d6lspb_:

Sequence; same for both SEQRES and ATOM records:

>d6lspb_ c.56.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d6lspb_:

• d6lspb_ is new in SCOPe 2.07-stable
  
• d6lspb_ appears in the current release, SCOPe 2.08