SCOPe 2.08: Domain d6kl7a2: 6kl7 A:176-396

Lineage for d6kl7a2 (6kl7 A:176-396)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [379468] (1 PDB entry)

8. Domain d6kl7a2: 6kl7 A:176-396 [379469]
   Other proteins in same PDB: d6kl7a1
   automated match to d2wtrb2
   complexed with ba, edo; mutant

Details for d6kl7a2

PDB Entry: 6kl7, 2.79 Å

PDB Description: beta-arrestin 1 mutant s13d/t275d

PDB Compounds: (A:) beta-arrestin-1

SCOPe Domain Sequences for d6kl7a2:

Sequence, based on SEQRES records:

>d6kl7a2 b.1.18.0 (A:176-396) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytldpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpesetpvdtnlieldtndddivfedfarqrl

Sequence, based on observed residues (ATOM records):

>d6kl7a2 b.1.18.0 (A:176-396) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytldpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrssdvavelpftlmhpkpkddivfe
dfarqrl

Timeline for d6kl7a2:

• d6kl7a2 first appeared in SCOPe 2.07