SCOPe 2.08: Domain d6u66b1: 6u66 B:107-244

Lineage for d6u66b1 (6u66 B:107-244)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)

8. Domain d6u66b1: 6u66 B:107-244 [379363]
   Other proteins in same PDB: d6u66b2
   automated match to d1c3ha_
   complexed with ca, na

Details for d6u66b1

PDB Entry: 6u66, 0.99 Å

PDB Description: structure of the trimeric globular domain of adiponectin

PDB Compounds: (B:) Adiponectin

SCOPe Domain Sequences for d6u66b1:

Sequence; same for both SEQRES and ATOM records:

>d6u66b1 b.22.1.1 (B:107-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gayvyrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitv
ymkdvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygegernglya
dndndstftgfllyhdtn

Timeline for d6u66b1:

• d6u66b1 first appeared in SCOPe 2.07