SCOPe 2.08: Domain d6o9ib2: 6o9i B:114-217

Lineage for d6o9ib2 (6o9i B:114-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6o9ib2: 6o9i B:114-217 [379238]
   Other proteins in same PDB: d6o9ia_, d6o9ib1, d6o9id_, d6o9ie1
   automated match to d4rgne2
   complexed with edo

Details for d6o9ib2

PDB Entry: 6o9i, 2.6 Å

PDB Description: ternary complex of mouse ecd with fab1 and fab2

PDB Compounds: (B:) Fab1 Light Chain

SCOPe Domain Sequences for d6o9ib2:

Sequence; same for both SEQRES and ATOM records:

>d6o9ib2 b.1.1.2 (B:114-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d6o9ib2:

• d6o9ib2 first appeared in SCOPe 2.07