Lineage for d6j75a_ (6j75 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (58 species)
    not a true protein
  7. 3079137Species Vibrio variabilis [TaxId:990271] [379199] (2 PDB entries)
  8. 3079153Domain d6j75a_: 6j75 A: [379215]
    automated match to d3ek1g_

Details for d6j75a_

PDB Entry: 6j75 (more details), 2.7 Å

PDB Description: structure of 3,6-anhydro-l-galactose dehydrogenase
PDB Compounds: (A:) Aldehyde dehydrogenase A

SCOPe Domain Sequences for d6j75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j75a_ c.82.1.0 (A:) automated matches {Vibrio variabilis [TaxId: 990271]}
qyqmyvggewidasngqtepvvspineevlayiqdadasdaervlavattaqkewakqpa
rqraevlrkfaqlirdnkqylaellvkeqgkllkvalgeveatstfieyacdwarqmdgd
ivksdnaneqimihkiprgvvvaitawnfplalagrkigpalvagnsivvkptsetplat
lelgylaeqagipagvlnivtgggrtlgnelvghrmtnmvsmtgstpagqsiirasannm
ahvqlelggkapfivmedadleqaaaaalhsrfdncgqvctcnermyvhgavydefmrif
mgkveaikvgdpmdpasdmgpkvnanelahmeelvaeavdegatvlfggkklegpefekg
fwfeptvltnvtqdmtivheesfgpilpvikfdsfdevieyandsdyglaamictqnmhy
inrlltelesgeiyvnrghgeqhqgfhngyklsgtggedgkygfeqylekktfyiny

SCOPe Domain Coordinates for d6j75a_:

Click to download the PDB-style file with coordinates for d6j75a_.
(The format of our PDB-style files is described here.)

Timeline for d6j75a_:

  • d6j75a_ is new in SCOPe 2.07-stable