Lineage for d6tsyb_ (6tsy B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304440Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2304479Species Thermosynechococcus elongatus [TaxId:197221] [379125] (1 PDB entry)
  8. 2304481Domain d6tsyb_: 6tsy B: [379181]
    automated match to d1c6sa_
    complexed with hec, so4

Details for d6tsyb_

PDB Entry: 6tsy (more details), 2.25 Å

PDB Description: cytochrome c6 from thermosynechococcus elongatus in a monoclinic space group
PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d6tsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tsyb_ a.3.1.1 (B:) Cytochrome c6 (synonym: cytochrome c553) {Thermosynechococcus elongatus [TaxId: 197221]}
adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
fagrltdeqiqdvaayvldqaakgwag

SCOPe Domain Coordinates for d6tsyb_:

Click to download the PDB-style file with coordinates for d6tsyb_.
(The format of our PDB-style files is described here.)

Timeline for d6tsyb_: