Lineage for d1aa8a2 (1aa8 A:195-287)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78269Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 78270Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 78322Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 78323Protein D-amino acid oxidase [54385] (2 species)
  7. 78324Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 78327Domain d1aa8a2: 1aa8 A:195-287 [37906]
    Other proteins in same PDB: d1aa8a1, d1aa8b1

Details for d1aa8a2

PDB Entry: 1aa8 (more details), 2.5 Å

PDB Description: porcine kidney d-amino acid oxidase

SCOP Domain Sequences for d1aa8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa8a2 d.16.1.3 (A:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1aa8a2:

Click to download the PDB-style file with coordinates for d1aa8a2.
(The format of our PDB-style files is described here.)

Timeline for d1aa8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aa8a1