Lineage for d6nxlg_ (6nxl G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (9 species)
  7. 2501491Species Human (Homo sapiens) [TaxId:9606] [54239] (296 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 3078973Domain d6nxlg_: 6nxl G: [379035]
    automated match to d4kskc_

Details for d6nxlg_

PDB Entry: 6nxl (more details), 2.8 Å

PDB Description: ubiquitin binding variants
PDB Compounds: (G:) Polyubiquitin-B

SCOPe Domain Sequences for d6nxlg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nxlg_ d.15.1.1 (G:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkesalillltl

SCOPe Domain Coordinates for d6nxlg_:

Click to download the PDB-style file with coordinates for d6nxlg_.
(The format of our PDB-style files is described here.)

Timeline for d6nxlg_:

  • d6nxlg_ is new in SCOPe 2.07-stable