Lineage for d6pydb2 (6pyd B:112-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760064Domain d6pydb2: 6pyd B:112-214 [378628]
    Other proteins in same PDB: d6pydb1, d6pydl1
    automated match to d1blna2
    complexed with p4s

Details for d6pydb2

PDB Entry: 6pyd (more details), 2 Å

PDB Description: structure of 3e9 antibody fab bound to marinobufagenin
PDB Compounds: (B:) 3E9 antibody Fab light chain

SCOPe Domain Sequences for d6pydb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pydb2 b.1.1.0 (B:112-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOPe Domain Coordinates for d6pydb2:

Click to download the PDB-style file with coordinates for d6pydb2.
(The format of our PDB-style files is described here.)

Timeline for d6pydb2: