SCOPe 2.07: Domain d6pydb1: 6pyd B:1-111

Lineage for d6pydb1 (6pyd B:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6pydb1: 6pyd B:1-111 [378627]
   Other proteins in same PDB: d6pydb2, d6pydl2
   automated match to d1blna1
   complexed with p4s

Details for d6pydb1

PDB Entry: 6pyd, 2 Å

PDB Description: structure of 3e9 antibody fab bound to marinobufagenin

PDB Compounds: (B:) 3E9 antibody Fab light chain

SCOPe Domain Sequences for d6pydb1:

Sequence, based on SEQRES records:

>d6pydb1 b.1.1.1 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsnrntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelk

Sequence, based on observed residues (ATOM records):

>d6pydb1 b.1.1.1 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivntylewylqkpgqspklliykvsnrfsgvp
drfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelk

Timeline for d6pydb1:

• d6pydb1 is new in SCOPe 2.07-stable
  
• d6pydb1 appears in the current release, SCOPe 2.08