Lineage for d2glsk1 (2gls K:1-100)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599288Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 599289Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 599290Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 599340Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 599389Domain d2glsk1: 2gls K:1-100 [37861]
    Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2

Details for d2glsk1

PDB Entry: 2gls (more details), 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution

SCOP Domain Sequences for d2glsk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glsk1 d.15.9.1 (K:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d2glsk1:

Click to download the PDB-style file with coordinates for d2glsk1.
(The format of our PDB-style files is described here.)

Timeline for d2glsk1: