SCOPe 2.08: Domain d6u3md2: 6u3m D:93-190

Lineage for d6u3md2 (6u3m D:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6u3md2: 6u3m D:93-190 [378531]
   Other proteins in same PDB: d6u3ma1, d6u3ma2, d6u3mb1, d6u3mc1, d6u3mc2, d6u3md1
   automated match to d1sebb1
   complexed with gol, nag, po4

Details for d6u3md2

PDB Entry: 6u3m, 1.9 Å

PDB Description: dq2-p.fluor-alpha1a

PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d6u3md2:

Sequence, based on SEQRES records:

>d6u3md2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records):

>d6u3md2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv
mlemtpqrgdvytchvehpslqspitvewra

Timeline for d6u3md2:

• d6u3md2 first appeared in SCOPe 2.07