Lineage for d2glsc1 (2gls C:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934814Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2934815Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 2934865Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 2934928Domain d2glsc1: 2gls C:1-100 [37853]
    Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2
    complexed with mn

Details for d2glsc1

PDB Entry: 2gls (more details), 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d2glsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glsc1 d.15.9.1 (C:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d2glsc1:

Click to download the PDB-style file with coordinates for d2glsc1.
(The format of our PDB-style files is described here.)

Timeline for d2glsc1: